Loading...
HomeMy WebLinkAbout52539-Z TOWN OF SOUTHOLD BUILDING DEPARTMENT SOUTHOLD, NY BUILDING PERMIT (THIS PERMIT MUST BE KEPT ON THE PREMISES WITH ONE SET OF APPROVED PLANS AND SPECIFICATIONS UNTIL FULL COMPLETION OF THE WORK AUTHORIZED) Permit#: 52539 Date: 12/11/2025 Permission is hereby granted to: Roman S Wilinski 1395 Oriole Dr Southold, NY 11971 To: install roof-mounted solar panels to an existing single-family dwelling as applied for. Premises Located at: 1395 Oriole Dr, Southold, NY 11971 SCTM# 55.-6-15.31 Pursuant to application dated 12/03/2025 and approved by the Building Inspector. To expire on 12/11/2027. Contractors: Required Inspections: Fees: SOLAR PANELS $100.00 CO „, ESIDENTIAL $100.00 Total $200.00 ia_i ding Inspector � � TOWN OF SOUTHOLD—BUILDING DEPARTMENT Town Hall Ann" 54375 Main Road P. 0.Box 1179 Southold,NY 11971-0959 Telephone(631)765-1 02 Fax (631) 765-95021 lQLQ1�5 /� � �� o� _�.. ._ .. �Li: � .o ) APPLICATION FOR Date Received IL, PERMIT / For Office Use Only PERMIT No. 525"7 Building Inspector: r ra 149" r ry w.�. Applications and forms must be filled out in their entirety. Incomplete applications will not be accepted. Where the Applicant is not the owner,an �til�ip , 1p : : Pit Owner's Authorization form(Page 2)shall be completed. Date:12/02/2025 OWNER(S)OF PROPERTY: Name:Roman Wilinski SCTM#1000- J����. � Project Address: 1395 Oriole Drive, Southold 11971 Phone#:631-383-8502 ::���Email:�%workboy44@optonline.com Mailing Address: 1395 Oriole Drive, Southold 11971 CONTACT PERSON: Name:Joseph Whitman Mailing Address:P.O gox 512 Phone#:631-734-5026 Email:peconicpowersys@9mail.com DESIGN PROFESSIONAL INFORMATION: _µ Name: Mailing Address: Phone#: Email: CONTRACTOR INFORMATION: Name:Peconic Power Systems Mailing Address:P.0 Box 512 Cutchogue NY 11935 Phone#:631-734-5026 Email:peconicpowersys@9mail.com DESCRIPTION OF PROPOSED CONSTRUCTION ❑New Structure ❑Addition ❑Alteration ❑Repair ❑Demolition DOther 5.93 KW AC solar Estimated Cost of Project: 22,000.00 Will the lot be re-graded? ❑Yes @No WIII excess fill be removed from premises? ❑Yes WNo 2 PROPERTY INFORMATION Existing use of property:Residential Intended use of property:Residential Zone or use district in which premises is situated: Are there any covenants and restrictions with respect to this property? ❑Yes 5QNo IF YES,PROVIDE A COPY. ❑ Check Box After IIW eadhig. The owner/contractor/design professional Is responsible for all drainage and storm water issues as provided by Chapter 236 of the Town code. APPLICATION IS HEREBY MADE to the Building Department for the Issuance of a Bullding Permit pursuant to the Building Zone Ordinance of the Town of Southold,Suffolk,County,Now York and other applicable Laws,Ordinances or Regulations,for the construction of buildings, additions,alterations or for removal or demolition as herein described.The applicant agrees to comply with all applicable laws,ordinances,building code, housing code and regulations and to admit authorized Inspectors on premises and In building(s)for necessary Inspections.False statements made herein are punishable as a pass A misdemeanor pursuant to Section 210.45 of the New York State Penal Law. Application Submitted By(print name):Joseph Whitman RAuthorized Agent ❑Owner Signature of Applicant:. Date: 11/25/2025 STATE OF NEW YORK) SS: COUNTY OF Suffolk Joseph Whitman being duly sworn,deposes and says that(s)he is the applicant (Name of individual signing contract)above named, (S)he is the Contractor (Contractor,Agent,Corporate Officer,etc.) of said owner or owners,and is duly authorized to perform or have performed the said work and to make and file this application;that all statements contained in this application are true to the best of his/her knowledge and belief;and that the work will be performed in the manner set forth in the application file th ,r+ with. u� Sworn before me this day of �" "". ,20 Nota4 Public LORETTA LAMB Notary Public,State of New York PROPER MIL I�I, ,Iml0RIZ I I #01 LA6179883 (Where e...applica�����.�. ���������� �.�ww............ ...���..�. Qualified in Suffolk County Wh�.th.... applicant nt ��is not the owner) Term Expires December 31,20 a Roman Wilinski residing at 1395 Oriole Drive do hereby authorize Peconic Power Systems to apply on my b all to the Town of Southold Building Department for approval as described herein. r 11/25/2025 Owner's Signature Date Print Owner's Name 2 ��.. 76 North Meadowbrook Drive Scott E. wyssling, PE Alpine, UT 84004 Heath J. Harpster, PE, P.Eng office (201) 874-3483 Gregory T. Elvestad, PE swyssling@wysslingconsulting.com December 18,2025 � w x Peconic Power Systems 315 Commerce Road, Cutchogue, NY, 11935 Re: Engineering Services Wilinski Residence 1395 Oriole Drive, Southold, NY 7.400 kW System To Whom It May Concern: We have received information regarding solar panel installation on the roof of the above referenced structure. Our evaluation of the structure is to verify the existing capacity of the roof system and its ability to support the additional loads imposed by the proposed solar system. A. Site Assessment information 1. Site visit documentation identifying attic information including size and spacing of framing for the existing roof structure, 2. Design drawings of the proposed system including a site plan, roof plan and connection details for the solar panels. This information will be utilized for approval and construction of the proposed system. B. Description of Structure: Roof Framing: 2x8 dimensional lumber at 16"on center. Roof Material: Composite Asphalt Shingles Roof Slope: 30&45 degrees Attic Access: Accessible Foundation: Permanent C. Loading Criteria Used • Dead Load o Existing Roofing and framing = 7 psf o New Solar Panels and Racking=3 psf o TOTAL= 10 PSF • Live Load =20 psf(reducible)—0 psf at locations of solar panels • Ground Snow Load =25 psf • Wind Load based on ASCE 7-16 o Ultimate Wind Speed = 134 mph(based on Risk Category II) o Exposure Category C Analysis performed of the existing roof structure utilizing the alcove loading criteria is in accordance with the 2020 residential Code of New York State (2018 lrC'). This analysis indicates that the existing framing will support the additional panel loading without damage, if installed correctly. ti Page 2 of 2 D. Solar Panel Anchorage 1. The solar panels shall be mounted in accordance with the most recent Ironridge installation manual. If during solar panel installation, the roof framing members appear unstable or deflect non- uniformly,our office should be notified before proceeding with the installation. 2. The maximum allowable withdrawal force for a 5/16" diameter lag screw Is 229 lbs per inch of penetration as identified in the National Design Standards ((NITS;) of timber construction specifications. Based on a minimum penetration depth of 2 1Z, the allowable capacity per connection is greater than the design withdrawal force(demand). Considering the variable factors for the existing roof framing and installation tolerances, the connection using one 5/15" diameter lag screw with a minimum of 2 1/2°" embedment will be adequate and will Include a sufficient factor of safety. 3. Considering the wind speed, roof slopes, size and spacing of framing members, and condition of the roof,the panel supports shall be placed no greater than 32"on center. Based on the above evaluation,this office certifies that with the racking and mounting specified„ the existing roof system will adequately support the additional loading imposed by the solar system. This evaluation is in conformance with the 2020 Residential Code of New York State(2013 IBC),current industry standards,and i based on information supplied to us at the time of this report. Should you have any questions regarding the above or if you require further information do not hesitate to contact me. truly yours, Co I / ,:°° ° N �✓ Scott E.Wyssling, " NY PE License No. 092303 NY COA No. 0022571 roIr mm �s I�i �apa�V��w�u ���t�m III �'�r�� 40����,,�u^� ��� "�,�" ��;o U �"IC s acVing under the cHrec y u sling prpsult m � ��.���t�t. Al l.l..0 affixt tWir Ram their;yea rid the notatiibn 76 N.Meadow brook Drive, pine l»wl"1"i ��W��,� mi�a�ro��4' �u�u iUlk��le�� a� �uc� �u� '11 1t Ir d y"R:Amed by th61r 8agnatijre and the New York COA#0022571 date of aii.m,h U e'r IPion,and a specifto �:� a�IriYp�da�lrr��of the aVt�n� l:li�x�� Signed 12/18/2025 Expires 7/31/2027 "Co?NUMULILMIG PHOTOVOLTAIC ROOF MOUNT SYSTEM ` ' ' 17 MODULES-SYSTEM SIZE STC (7.40 kW DC/5.93 kW AC) 1395 ORIOLE DR,SOUTHOLD, NY 11971, USA(41.0732476,-72.4212422) SYSTEM SUMMARY STC(7AO kW DC t 5,93 kW AC) SHEET INDEX STCDC:(17)435W=T40kW ,,.- PV-1 COVER PAGE STCAC.(17)349W-S.93kW - 1 PV-2 SITE PLAN WITH MODULES (t7)HYUNDAI ENERGY SOLUTIONS CO.,LTD.HIS-T435NF(BK)MODULES / `t_ PV-3 ATTACHMENT DETAIL ra,xuxz (t7)ENPHASE ENERGYINC.IQSA-72-2-US 12401A MICROINVERTERS / ELECTRICAL ONLY PV4 SINGLE LINE DIAGRAM PV-5 I x BRANCH.OF B CONNECTED IN PARALLEL .- WIRING CALCULATIONS • 1x BRANCH OF 9 CONNECTED IN PARALLEL \ Mkt 4�01'�{Y PV-fi PLACARDS wcu�.s.�rceaeza GOVERNING CODES ,,,y,-a uTHO'dR,g�O°g,�.. PV-7+ EQUIPMENT SPECIFICATION 2020 NEW YORK STATE FIRE CODE ;;} i - - 2020 BUILDING CODE OF NEW YORK STATE 7* G� €+ -. AHJ:SOUTHOLO(TOWNSHIP OF},NEW YORK • 2020 NEW YORKSTATE RESIDENTIAL CODE xu UTILITY:PSEG LONG ISLAND • 2017 NFPA 70-NATIONAL ELECTRICAL CODEk1 ` g - - +� z O GENERAL NOTES \\ 1) ALL PANELS,SWITCHES,ETC SHALL HAVE SUFFICIENT GUTTER SPACEE 'L{. Y` AND LUGS IN COMPLIANCE WITH UL REQUIREMENTS TO ACCOMMODATE - C1 0994.7IN tO CONDUCTORS SHOWN k41 -y 2) THIS SYSTEM WILL NOT BE INTERCONNECTED UNTIL APPROVAL FROM THE ( �L RRAYLOCATION(S LOCAL JURISDICTION AND UTILITY IS OBTAINED. 1 1 3) A4.[.EXTERIORELECTRICAL DEVICESAND EQU3PMENT INCLUDING THOSE -{; WysSIjng CQt1g{,{nqi PLLG THAT ARE EXPOSED TO OUTSIDE ENVIRONMENT SHALL BE ' kl ;y 76 N.MeadoWINOOk DTf-,MINI.UT WEATHERPROOF AND SHALL BE LISTED BY'UU FOR THE TYPE OF APPLICATION AND'UU LABEL SHALL APPEAR ON ALL ELECTRICAL .S -- _ New York COA Al 02ZO92 EQUIPMENT. Signed 11/26/2025 4) WIRING METHOD SHALL BE EMT ABOVE GROUND MOONTED IN _ ' CONCEALED SPACES(UNLESS APPROVED OTHERWNSE)AND SCHEDULE40 - - Expi 7WI2026 PVC FOR BELOW GROUND INSTALLATIONS UNLESS NOTED OTHERWISE. { 5) AN OSHAAPPROVED LADDER PROVING ACCESS TO ALL PORTIfNdSOR .E L,.USS THE ARRAY SHALL BE SECURED IN PRIOR TO REQUESTING INSPECTION- 6) IT IS THE CONTRACTOR'S RESPONSIBILITY TO INSTALL A SUPPLEMENTAL 'L GROUNDING ELECTRODE CONDUCTOR IF NECESSARY. _ _ lap APP VEO AS NOTED DA , S B.P. 22 � p \� FEE, G BY: v �vD1W PORK ST E&TOv "N CODES1 j'H Al-L CODES OF c N NOTIFY BUILDING DEPARTMENT AT AS REQUIRED AND CON DITIC S OF 631-765-1802 8AM TO 4PM FOR THE '- FOLLOWING INSPECTIONS SS 0I I DT 3A - t HOUSE PHOT Z n rn 1. FOUNDATION- O REQUIRED R m TVV a y � � FOR POURED CONCRETE , ,`4 + \ _ O Y w-I2. ROUGH FRAMING&PLUMBING T ..4{ \\\ Z O p z a w 3. INSULATION J a 4. FINAL-CONSTRUCTION MUST OLD �v \\ \ \\\ O BE COMPLETE FOR C.O. -,, ' ' `-_ \ \\\\`\��~\ ALL CONSTRUCTION SHALL MEET THE O REOUIREIVIENTSOFTHE CODES OFNEW YORK STATE N` RESPONSIBLE FOR DESIGN OR CO-� t UCTON ERRORS _ > ! ' , t �T -- FENCE �' P 1 Y}� \\ \T\\\\ NEW PV MODULE - 1 a } ✓T % 1 \\ \`\\ O\ ®FRONT OF HOUSE _.. GATE USE @@ � � E DRIVEWAY lc f .� ss� Ix ' � \ `\\\\\\\\\ DIMENSIONS 1 OU ER T ��� TT COVER PAGE - u- \. \\_ --PROPERTY LINE POOL - 1 �..a - PA OBSTRUCTION OF = k MY RO,fECT SITE - �1 AC JUNCTION BOX :MAIN SERVICE PANEL a f \m ANSI B (NEW) �` (EXISTING.125A) CINg € ,/ VIC - _ 11"X 17" ELECIR IQ COMBINER 5.5C UTILITY METER ki } fV g fh e- (NEW) x m (EXISTING) - i§ P N E €ls _ ^``� �..«>__- v _ � �� ACOISCONNECTUNFUSED - - T_�$� P V 3(NEIV) O MO{}ULE AREA 8 WE3GHT CALC7EBULATIONS „n' rmooa'�,�a+;a' d,` ELECTRICAL ONLY o`NEj}-y a wv;,Hr.nn ae=s,t O9 g41@ y �xoAoat+» .s`secba€MATERtaLs Wyss#inq Consulting.PLLC twre ..€s 76 N. cntr#ddw,Alpine UT �,Fcmo-xureasEr.cAt�. xe..rots con a ez2osz Signed 11/26/2025:§Aa _ cttasmEfes+u f€B 1 Expires 71312026 Its Ll ; ACdSWnriECT t SdJNNEGT `1 2aPVACI isOdA� �.A.& LaPttAx�S C=RdkBMiG U6 }% ROOF@ESCR< ON TABtE M _ VL P&&irtk �4P.kG 1 ii �3mN t5^ _ 9(3a•) �ft 'S ntao.c HS)a ROOF ACCESS POINT xr . f aT f f ' SURi ASvflt+0.�w5�WCRS. - ff fi t { 'E F W,MpvEPHEcO 'AGxG�wiS t�eW.IXN C n S ffi f § DESIGN CRITERIA G� - ?�frf'. ROOF ACCESS POINT PPRj f9ff \ Y J s..f ` _ t R O Y Ui u Z �a¢ ROOF ACCESS POINT °'° ' B 0 o s (t) UM NEW WMODULE FRONT OF HOUSE _ J FtRE SETBACK OBSTRUCTION ? } Sy-_= �,� _ � OPTIMIZER RAF SStSEAM TERITRU $; SITE PLAN WITH ' MICROdNVERTER RAIL , MODULES i ROOF ATTACHMENT CONDUIT �O 7, �1`�L ANSI B i AC.IUNCTION BOX ',�MAIN SERVICE PANEL i (NEW) (EXISTING.125A) 11"X17" ?F'10(NEWMBINER 5t5C -LITY(EXISTING) R AC DISCONNECT UNFUSED TE v� '€�?L `A`D—L ES € � PV_2 (NEW) REFER TO ROOF DESCRIPTION TABLE IN PV-2 FOR MOUNTING PLANE DETAILS �-�PV MODULE ROOF // SEE ENLARGED VIEW fa i rn RAFTERITRUSS s CATF: __�. _ D .sue LE,N PV MODULES IRONRIDGE INTEGRATED N GROUNDING&END/MID Y 0 CLAMP IRONRIDGE RESOURCES XR100 >J I I i ROOF > t Z N o a Z O dj z a w o O ~ o FLASHING m ALUMN."L"BRACKET W/3/8"SS BOLT&NUT IRONRIDGE RESOURCES-FLASHFOOT2 ATTACHMENTS 5/16"x3.5"SS LAG BOLT '"- " WITH MIN ZYz"THREAD ATTACHMENT EMBEDMENT,SEALED DETAIL PENETRATION RAFTER/TRUSS ---``"- ANSI B 11"X 17" __-- -- ---- ----- _--- -_- _"--' INTERCONNECTION 120%RULE EXTREME CASE MODULE OUTPUT SYSTEM SUMMARY STC(7.40 kW DC 15.93 kW AC} (MAIN PANEL) (HYUNDAI ENERGY SOLUTIONS CO.,LTD.HIS-T435NF(BK)) STC DC:(17)435W=7.40 kW { UTILITY FEED+TOTAL BACKFEED - - + STC AC:(17)349w=5.93 kW - 1 OOA+35A=435A Isc(T)=Isc(25-C)x 11+Tisc x(T-25 C)) • (17)HYUNDAI ENERGY SOLUTIONS CO.,LTD.HIS-T435NF(BKj MODULES I = f Isc(-19°C)=13.92A,Isc(30`C)=14.22A : (17)ENPHASE ENERGY INC.IQBA-72-2-US[240V]MICROINVERTERS = LESS OR EQUAL TO _ - ? . 1x BRANCH OF 8 CONNECTED IN PARALLEL - BUS RATING x 120% Voc(25"C)=38.90V,Tvoc=-0.250%1°C • 1x BRANCH OF 9 CONNECTED IN PARALLEL 125A x 120%=150A a (Voc(T)=Voc(25°C)x[t+Tvoc x(T-25 C)] Voc(19'C)=43.18V,Voc(30°C)=38.41 V CALCULATION ENSURES BUS IS SAFE REGARDLESS OF LOADS GNATIRE SEA BI-DIRECTIONAL MAIN SERVICE PANEL UTILITY METER _ (EXISTING,TOP-FED) METER NO:098367363 UTILITY:PSEG LONG MOD:HYUNDAI ENERGY SOLUTIONS j�! BUS RATING:125A ISLAND CO.,LTD.HIS-T435NF(BK) .j (2 $ IQ COMBINER 5/5C MAIN BREAKER:100A(E) s INV:ENPHASE ENERGY INC[ I #(X IQ-AM1-24b5) SERVICE:240V 60HZ 1PH (� IQBA-72-2-US[240 n[_,_,_,, TO CONSUMPTION CT— i�� PV VISIBLE LOCKABLE 100A(E) t A � TO (1 BRANCH X 8 MICRO-INV) ---� 'I=. JUNCTION BOX c.-� 1 — '#r� ,{M ? To r.-; p4iS-01 E€ LABELED DISCONNECT 600V,NEMA 3R ,r,,,E.1av { CT l, GRID - 12AWG Q-f.ABL :UL LISTED [r��-j (60A UNFUBED 1PH 240VACj O6 AWG Cu BARE G(BOND RACKING) `15A LC-01T r= j 1MCB-01 20A{N}i MOD:HYUNDAI ENERGY SOLUTIONS F 1 [c' MCB-02 20A(N}j CO.,LTD.HIS-T435NF(BK)i ,[ .2 INV:ENPHASE ENERGY INC 4i IOBA-72-2-US[240V)1 i II - _ Q lei - (1 BRANCH X 9 MICRO-INV) --.-� 1 = ELECTRICAL ONLY Y 35At-e N.)1)- I 12 AWG Q-CABL � OF N>;;'i Y Z tY O6 AWG Cu BARE G(BOND RACKING) !lyygV0;;4 ,3 W t -T GROUND ROD `4 iti Z z¢ �' ou Z O 0 zaw 1 sfic 099411 2 V O �S} O Wyssfing Consu".PLLC U) 76 N.b#e 04—Mpme UT New Yark CDA 8 022082 Signed 11/26/2025 E)p-713U2026 S-.z_T NAAE SINGLE LINE ELECTRICAL NOTES AC wire details DIAGRAM 1) ALL GROUNDING TO COMPLY WITH NEC 690.47. �M, Live Neutral Ground MinEMT Min PVC Min RMC 2) ROOFTOP CONDUIT OR CABLES SHALL BE LOCATED MIN.718-ABOVE ROOF SURFACE.3) ALL TERMINALS SHALL BE MIN.75°C RATED. 12 AWG(Q-Cable) _ O6 AWG BARE _4) IQ GATEWAY BREAKER DETERMINED AT FACTORY BY MANUFACTURER(20A). (NOT 1N CONDUIT} ANSI B 5) FOR IQ GATEWAY:USE SINGLE CT FOR PV PRODUCTION(Lt FROM ALL PV BRANCH CIRCUITS).USE DOUBLE CTs FOR MS-02 16.31A 12 AWG(Q-Cable) _ 06 AWG BARE - _ _ 11 e X 17" CONSUMPTION(Lt AND L2 FEEDING MSP MAIN BREAKER,SERVICE SIDE). (NOT IN CONDUIT) MCB-01 14.50A (2)10 AWG THWN-2 - 10AWGTHWN-2 1/2 in 1t2 in 1/2 in _ _ y _ MCB-02 16.31A (2)10 AWG THWN-2 - 10 AWG THWN-2 1/2 in 1/2 in 1/2 in PV-4 =SUE T IAL .NG-7L.: i I N _A _ LC-01 3281A (2)8AWG THWN-2 8AWG THWN-2 10AWGTHWN-2 1/2 in 1t2 in 1/2 in INTERCONNECTION 120%RULE EXTREME CASE MODULE OUTPUT SYSTEM SUMMARY STC (7.40 kW DC 5.93 KW AC) (MAIN PANEL) (HYUNDAI ENERGY SOLUTIONS CO.,LTD.HIS-T435NF(BK)) STC DC:(17)435W=7.40 kW 'UTILITY FEED+TOTAL BACKFEED 1 Isc(25°C)=14.19A,Tisc=0.043%1°C STC AC:(17)349W=5.93 kW _ 100A+35A=135A Isc(T)=Isc(25°C)x[1+Tisc It(T-25°C)] ) • (17)HYUNDAI ENERGY SOLUTIONS CO.,LTD.HIS-T435NF(BK)MODULES Isc(-19°C}=13.92A,Isc(30°G)=14.22A i LESS OR EQUAL TO I • (17)ENPHASE ENERGY INC.IQ8A-72-2-US[240V]MICROINVERTERS - BUS RATING x 120% Voc(25°C)=38.90V,Tvoc=-0.250°l°t°C ( 1 125A x 120%=150A Voc(T)=Voc(25°C)x[1+Tvoc x(T-25°C)]_ • 1x BRANCH OF 8 CONNECTED IN PARALLEL = _ a� a • 1x BRANCH OF 9 CONNECTED IN PARALLEL CALCULATION ENSURES BUS IS Voc(-19°C)=43.18V,Voc(30°C)=38.41V w, SAFE REGARDLESS OF LOADS " AC wire details WirelD #Modules Nomrnal Backfeed't.25 Min OCp Total Conductor CcConductom Expected Adjusted ampacity(ampacdy x temp Conductor& EGC size Conductor Maz V drop Min EMT Min PVC Min RMC Voltage lcond.set Power sets /conduit max temp Berate x conduit fill derate) neutral size (Cu) metal teng01 size size siza MS-01 8 240 V 14.50 A 20 A 2.8 kW 1 2 30 25 x 1.00 x-=25.00 A 12 AWG(Q-Cable) 06 AWG BARE Cu 50 It0.83% - - - (NOT IN CONDUIT) MS-02 9 240 V 16.31 A 20 A 3.1 kW 1 2 30 25 x 1.00 x-=25.00 A 12 AWG(Q-Cable) 06 AWG BARE Cu 50 It0.93% - - - _ (NOT IN CONDUIT) ___ P' _ MC"I 8 240 V 14.50 A 20 A 2.8 kW 1 2 30 35 x 1,00 x 1.00=35.00 A (NO NEUTRAL) 10 AWG THWN-2 Cu So It 0.50% 112 in 1/2 in 1/2 in MC"2 9 240 V 16.31 A 20 A 31 kW 1 2 30 35 x 1.00 x 1.00=35.00 A (NO NEUTRAL) 10 AWG THWN-2 Cu soft 0.56% 1/2 in 112 in 1/2 in LC-01 17 240V 30.81A 35A 5.9 kW 1 2 30 35x 1.00x I.00=35.00A 10AWGTHWN-2 I 10AWGTHWN-2 Cu loft 0.21%1 112 in 112 in 112 in 6 Y � rh ELECTRICAL ONLY Z o rn m y ti�1=New J *" �O O >- j 'a^e{,ttTO>aA 94- Z 6 o a l >-z O O z=2,a M O D 09947% L SSI ELECTRICAL NOTES 1) ALL EQUIPMENT TO BE LISTED BY UL OR OTHER NRTL,AND LABELED FOR ITS APPLICATION. Wyesling Consulting,PLLC 2) ALL CONDUCTORS SHALL BE COPPER,RATED FOR 600V AND 90-C WET ENVIRONMENT. 76 N. On-,Alpirw UT 3) WIRING,CONDUIT,AND RACEWAYS MOUNTED ON ROOFTOPS SHALL BE ROUTED DIRECTLY TO,AND LOCATED AS CLOSE AS POSSIBLE TO THE NEAREST RIDGE,HIP,OR VALLEY. N-York COA a 022092 4) WORKING CLEARANCES AROUND ALL NEW AND EXISTING ELECTRICAL EQUIPMENT SHALL COMPLY WITH NEC 110.26. Signed 11/2612025 _ 5) DRAWINGS INDICATE THE GENERAL ARRANGEMENT OF SYSTEMS.CONTRACTOR SHALL FURNISH ALL NECESSARY OUTLETS,SUPPORTS,FITTINGS AND ACCESSORIES TO FULFILL APPLICABLE CODES AND STANDARDS. 6) WHERE SIZES OF JUNCTION BOXES,RACEWAYS,AND CONDUITS ARE NOT SPECIFIED,THE CONTRACTOR SHALL SIZE THEM ACCORDINGLY. Expires 7(31Y1026 7) ALL WI RE TERMINATIONS SHALL BE APPROPRIATELY LABELED AND READILY VISIBLE. WIRING 8) MODULE GROUNDING CLIPS TO BE INSTALLED BETWEEN MODULE FRAME AND MODULE SUPPORT RAIL,PER THE GROUNDING CLIP MANUFACTURER'S INSTRUCTION. CALCULATIONS 9) MODULE SUPPORT RAIL TO BE BONDED TO CONTINUOUS COPPER G.E.C.VIA WEEB LUG OR ILSCO GBL-4DBT LAY-IN LUG. 10) PV EQUIPMENT SHALL BE DESIGNED AND INSTALLED IN ACCORDANCE WITH NEC 690. 11)EXACT LOCATION OF AUXILIARY GROUNDING TO BE DETERMINED AT TIME OF INSTALL. 12)EXISTING WIRES MUST BE REPLACED IF SMALLER THAN LISTED MINIMUM SIZES PER NEC 310.15(B)(16). j- 13)IQ GATEWAY BREAKER DETERMINED AT FACTORY BY MANUFACTURER(20A). ANSI B 14)FOR IQ GATEWAY:USE SINGLE CT FOR PV PRODUCTION(LI FROM ALL PV BRANCH CIRCUITS).USE DOUBLE CT.FOR CONSUMPTION(LI AND L2 FEEDING MSP MAIN BREAKER,SERVICE SIDE). 1 1 n X 17" WIRING - CULA-1-1-03NS PV-5 CAUTION : ELECTRICAL slioCK HAZARD - POWER TO THIS SERVICE IS ALSO SUPPLIED TERMINALS ON BOTH LNE I - AND LOAD SIDES MAY N - - FROM THE FOLLOWING SOURCES WITH ENERGIZED IN THE OPEN ' DISCONNECTS AS SHOWN POSITION LABEL LOCATION:AC LABEL LOCATION:INVERTERS, COMBINER PANEL(WHEN , DC&AC DISCONNECTS,DC& APPLICABLE FOR PV LOAD AC COMBINER PANELS(IF CENTER) , APPLICABLE) CODE REF:N/A o . CODE REF:NEC 2017- nL'TY METER _ "TILITY METER MAIN SERV E PANEL LABEL LOCATION:ADJACENT TO BACKFEED BREAKER IN COMBINER PANEL LABEL LOCATION:UTILITY SUBPANEUMSP(IF `- INTERCONNECTION DISCONNECT(MSP APPLICABLE) OR AC DISCONNECT),AND WHEREVER CODE REF:NEC 2017- REQUIRED BY AHJ(DC DISCONNECTS, 745.12(BX2)(3xb) INVERTERS) 1395 ORIOLE DR,SOUTHOLD, NY 11971, MA CODE REF:NEC 2017-690.56(C)(3) ss-, USA y LABEL LOCATION:MSP CODE REF:NEC 2017-705.10 LABEL LOCATION:MAIN PANEL NOTES AND SPECIFICATIONS -..• g ,-, 3- -�'3 - -._ CODE REF:UTILITY 1) SIGNS AND LABELS SHALL MEET THE REQUIREMENTS OF NEC 110.21(B),UNLESS SPECIFIC LABEL LOCATION:AC DISCONNECTS,PV POINT OF INSTRUCTIONS ARE REQUIRED BY SECTION 690,OR INTERCONNECTION SOLAR PV SYSTEM EQUIPPED IF REQUESTED BY THE LOCAL AHJ. CODE REF:NEC 2017-690.54 2) SIGNS AND LABELS SHALL ADEQUATELY WARN OF Y j WITH RAPID SHUTDOWN HAZARDS USING EFFECTIVE WORDS,COLORS AND ELECTRICAL ONLY U -- SYMBOLS. z Ofn £ 3) LABELS SHALL BE PERMANENTLY AFFIXED TO THE t OE NEG;3 y rn -- EQUIPMENT OR WIRING METHOD AND SHALL NOT BE f ai a Nfl�lq c 9,)- J Lu 1 TURN RAPID SHUTDOWN HANDWRITTEN. �J �F r > O >- '4 w # 4) LABEL SHALL BE OF SUFFICIENT DURABILITY TO * _ �`- > R Z 6 o '. SWITCH TO THE �______.7 r i WITHSTAND THE ENVIRONMENT INVOLVED. n Z O p z a w LABEL LOCATION:AC DOWN pWF'POSmON TO SHUTyYS7E�p L-- --� 5) SIGNS AND LABELS SHALL COMPLY WITH ANSI Z535.4 :';' Q Q Ln DISCONNECT,PV BACKFEED AND REDUCE -2011,PRODUCT SAFETY SIGNS AND LABELS, 2, v M O= BREAKERIPOINT OF SHOCK HAZARD UNLESS OTHERWISE EXISPESTING MANUFACTURER �« �a?g 0 O INTERCONNECTION IN THE ARRAY. 6} DO NOT COVER EXISTING MANUFACTURER LABELS. a5i0 � CODE REF:NEC 2017-690.13(B) Ln Wyssling wk Od*.PLLC 78 N. Woak Arke,Ate UT New York con!022082 m�' 3=3 LABEL LOCATION:INTERCONNECTION POINT(MSP OR AC Signed 11/26/2025 DISCONNECT IF LINE SIDE TAP) Expkes7W=26 CODE REF:NEC 2017-690.12,NEC 2017-690.56(C) --__`-$=`-•1= LABEL LOCATION:INTERCONNECTION DISCONNECT FOR UTILITY ACCESS PLACARDS CODE REF:NEC 2017-690.13(B)OR UTILITY ANSI B 11"X 17" LABEL ERLOCATION:PV PRODUCTIONME PV-6 CODE REF:N/A H DHD,yEuRN , GY,,LUT,,,, Electrical Characteristics HD HYUNDAI SOLAR MODULE .1 ZID, 1 ",31 Isr,5a 3c i 3i 31 -32 21 A 141- 1310 NF(BK)Series 76 2�_2 22 Premium N-Type TOPCon Module 2an ToS-T4-,5NF'BK)i HiS-43011,F(R-K)I I liS i 43 ,N'F(BKI S 2s, Mechanical Characteristics Installation Safety Guide C_ cp­,­�1—p—t- 1—ft 2 0,,) aN�rtOre —1 2 Shipping Configurations U) z Module Diagram(.nh: I-V Curves(HIS-T430NF(BK)) z Z -7` of 0 z 0) 6 i Riflill RIMP Hu Q - 0- K ROOM WIN MADJUMM CK 0 U) Hfigl,., L.n-T.- Forresidential ,o,2 2 1,12 -� 28%ncy High-End s g 141 111-41 Efficie TOrCon facialfi Refielenlity (F�t!81­k De�ignl Technology ic— Carcxntw F-4 11-2�10 HD Hy.nd.fs Warranty P—I,li­ 0—c—c-o— ceqfficatim — ?Ex aanaara EQUIPMENT -25 —d—W--, 211 n t 87.4% SPECIFICATION Yell"Iffoll—Wal—ty -vunhn (30 ct IHYUNDAI ANSI B MENERGYSOLUTIONS 11"X17" PV-7 n.ENPNASE OEM 108M and 108A Microinverters 1 Gemmc JYused module paitMgs` w 260-A66 235-590 wNxaa4 m7rpcvrc,mguE Module eom abRy S4-cell[t96 half-ceY.60-cellt120 halt-ceX,66-cel111.hall-tee and12,.1144haif-cell Ili MPPT vdtage range Y so as 32-45 Op"mgange V IB-Sa Min.f Maxstartvokage V 3it56 c�crzacntU"-eT,aExcuaxa Max input DCvdtage Y W - Max.cgn➢nucusinput OC current a 12 cl�:may P ~ - Max.input OCsficrt-circuit<wrent A 25 Max mgdWel A 20 cvervdtagedass OG port X lK portbackte Hcwrem mA O PYarzayconfywation ixt Uryroundetl array.Npaddiitonai DC vdeprotectionreguked:ACsitlepratactMnregupmmex20Aparbranchck— Faek ou,putppwar VA 330 366 Max.cant(nuwu outpuipo»'er YA 32S 349 Norrvnai{l-L}vdtagafrange' V 240f2R-264 Max.conpnuweoa[Wtcurzent A t35 L45 IQBM and IQBA Microinverters Npm aFrage e0 ournaweatf48Micrdnvertarsare the industr first mitt d-fwmin Yt0lnamp Extended freguenw rarge !p 47-68 y's ogri g.software defined Eas metiers with spl,tph,sa power oon—k,rr,capablty to canxert DC power to AC Lighiweightand compact with Plug-1- play cennectws 3M� Aga H{ „'G--. x.lh-C- application spadfic Integrated dreWt(ASIC)which enables the microinrertar taoperate in Max udr,par 29 A(Li)branch ctrwa' v grid-dadaraff-gddmodes.This chip is built IN d—cad 55nm taohnology with high Speed Power Ll-Communicailon(PLC) digital loge and has wparf..response times to changing loads and grid evans.alleviating between ecrnponerrcs rota)ha„r,oMe dinwnon �5% constraints on battery siting for home anergysystems. Fasta,installation with simple two-vrire prarvNtagedess AC port lil cabpng Pc portlaackfeed current mA 3c Hlgh productivity and rebabilFty Prover famor—rN, to Q Q951eaMng-0.861a99ir,9 . .Proa,papawar aYanwnen the grid is srla.tlad Porter t—(adustabM) dawn Peak efaciarrcy 4T5 0)? A/J More than onamll,on cumulahve hours CEC are ghiedefflGency X 91.5 9I �_ Q of testing 60 J Lu us Part pf the Enphase Energy System.l48 I,]8 Series Microinverters redefine Night-timepower mnwmptbn Series Microirnerters integrate with the reliability standards with mare than ane Class IIIdauWe-insulated andosure iQ Bette,, Gateway,and the Enphase miN(on curtuilative hours of powarron Cptimixadfar the letasthigh-powered S ° r �T` W App monitwing and analysis software. testing,enabling an indrxstry-leading PVmodules Amtyant,a➢paratureraWe -49'C to+60'C id0'Fm H4o'F} Z rra p Xmlted warranty of up to 25 years. RelaNvabunitlitY range 4%ta t00%(cgndenN,g) < 0 a s W MFcrogrid-formitrg OC MC4 C Connectwtypa W o a G a Complies with the latest advanced grid Zt2 mm(5.3')x RS mm(G4')x 30.2mm R2'7 r2 i[Vtj wppert" Wmenv«,stNxW xD) O D Remote automatic updates for the —ight L06 kg(2.3a Ws) n/ iatestgridregtdrements Coding Natwal cenrrecNm-nofena LL N Connect PVmpdules quickly and easily IQa Series Mic rs are UL UL list rid p e g d C rabla to suppwtawide range Approved tin wetioca➢ans ys to ICS Series Micraimertws using the as PV Rapid Shutdown Equipment and of grid prattles includedl,y C 4,ads tar cable wtth mnfarm with ious re lafa—when Meets CA Rude 21(UL 1741-SA)and IEEE Poilunond pD3 plug-n-piaYMC4 coon clots. installed according to arwfacturer's 1547:2018(UL 1747-563'Ed) Fixias,ae Clan Ndw&te-insNated certovgnrevstam Wiymerm eacWwre vtstruations. Envirory category f UYexpwure ra➢'ng NEMA lyps 6 f wtdoor tin S E-l-NAME msotFrc➢_-_'tmcr�svanersfto't CA RWe2i(ULtJ4t-5A),UL62109-t,lEEE 1541:20ta(ULP4t-563'Ed.},FCC Part15 Clsas6,ICE6-0003 CWss&CANf CSA-C222N0.tOJ3-Ot EQUIPMENT wrem}a+Urezanwsystem. Certificatgns TNsproductis ULLrstadas PY PapW Shutdown EgWd wnrarma with NEC 20M,NEC 20V..andNEC202tssection69D.12arMC22.t- win. zm Xt . M�,o6 29�R�<64-n6Rapld tdgwnatFY6 at m arA9pmenatanD�<o d iwaw Xedaaand;ng,em wN a�'ainat�ti9rta. SPECIFICATION IoSMandro�; ,�1;=p6a,a�4oY.�",a5�ra,. 9iFw�aPYa�a,»�,war�aa6m�m.lip,ma,rm�,t���a�N .g�,.a�,~a�waF��M��:amr,t a�e�ar,wna.,re„adw�,..aoteF�g»A�.p�a».�.�atte m.M<-,�Aaa-0aaao3EN-.>=--27 vFfE--slZE ANSI B 11"X 17" PV-8 ENPHASE. IQ Combiner 5t5C IQ Comb ca,5with tQ Gateway Feinted circuit board fo—degratad revenue-grade PV productioncoussig(ANSI Ct220 05%)consumption wor'mg p_2.5%).and IQ conrorowsn IQ Combiner5 6ardrypyt*­g(±2 5%).AckdoIasd solarshieldtodefiect heat. (X-)Q-AMi-240-5IX-I0-AMi-240-5-NOK) 10W te � } se fw a he ry'a4£ drcwt beakers ment[onedMtheA roles add Replacement Pontesecbon - copev�cERcvw cvrowcuE n4v,mim ID CaaRb6 5Cwth10 Gateway pa rutpd eoutboard for_ -grated ran Vro t at�}iANSEG2 % a Pa {i25%). d c IQCombinar SC 10 EINtery monttarbug(t2.5nincksdes EcphaeO Mobile Concoct cmkdar modom (t-10-AMi-240-5C/X-10-AMI-240-5C41DK) (CELLMODEM-Mi OB SP-05).Include I hieldt coact h t = `�I` IQ-AM12405CHOK mcludes a factory installed hold-down kit compatible whh am the WONvenitbreakers entlorded in the Acee or)esardd Reptacerrent Partssaction. . c m ss MINE IQGatewa I the Iatformformtal energy ntfdre hensve,nuS.t. ys p rgy maa Energy ompm �\ X-IQ-AMl-2AQ-S-HDK IQ Gateway pr&rted circuit boad mantanance,aM management of the Enphase Energy System X.-AMt$40-5 HK eusbar D tQ-AMF240-5 80Abasbarwithsupportfo,o IOGatewayb(eakerand four20Alta-kersfa -- X-tQ-AMt-240-SC installing IQ Series Micranverters and IQ Battery SP IQGatewaybreeker Circuit breaker,2-pole.lO A/15A =-_RE SEAL production CT Pra-wired revenue-grade sofidc m CT,accurate up to z0.5% IQ Combiner 5/5C Consumption CT Two consumptiari nret nW clamp CT.shipped with the box.accurate up to 35% Smart IQ Battery CT One battery meterlrg clamp CT,shipped with the bo,accurate up to±2.5% The lO Combiner 5/5C consolidates interconnection equipment into engia enclosure and InchdesIOGatewayfor Control board for wired communicaticn with IQ System Controller 3/3G and the streamlines lO Series Micvoimertem and IQ Gateway Installation by providing a consistent. communication and control CTRL board IQ Battery 5p pre,ekadsolution for residential applications.IQ Combiner 5/5C uses wired control includes Enphase Mobile Connect communication and is compatible with lO System Cots-ROW 3/30 and lO Battery SP. (CELLMODEM-MI-06-Sp-05L only EnphaseMobile Caaact(enly with b Combiner SC) OGaplan LTE-Mi cellular modem(CELLMODEM-MiAB-SP-0S)wtfha5-year T-Mobile with IQ Combiner SC data The lQCombi P—id, complies Micromvarstic EOSysteEergy Syiar373G.and Accessories kit 5 reel headarsfor the GOMMS-KIT-26oard b Battery SPprovide acmmplete gnd agnostk Enphase Energy myrtem. Supports flexible neiworkirg:Wi-Fi, Pamcon EthmnetorcelWiar ACCESSORIES AND REPLACEMENT PARTS!NOT INCLUDED.ORDER SEPARATELY! •Provides production metering CELLMODEM-M1-06-Sp-05 4G-based LTE-Mi ceffule, ,dim with a5-year T-Mobile data plan {revenue grade)and consumption monitoring CELLMODEM-1,11-06-AT-05 4G-based LTE-MicMuier modem with 5-year AT&T data plan L Eas to lnamii Supports Eaton BR2W_-R—ans 02M,and GF/A88 THQL2=San-c I"cut breakers Y Circuit braakers(o Hire-shelf) (XXrepresents10,15.20.3a40,50.or60).Alsosup=MEaten BR2203,8R2308.and Q Mounts to one stud with centered BR2408 circuit WeaterscompatWla with the hold-down kit 10 Series Mkrdirwapt s 10 System Controller 313e brackets BRK-t0A-2-240V,BRK-I5A-2-24OV,BRK-20A-2P-240V.BRK-15A-2P-240V-B,and 'ilk The high-powered smart gold-ready lO Series PmAdm micr nn on ogrid intenooecti dayice Circuit liassars(pravded by Enphase) BRK-20A-2P-240V-B(more details in tine s"s U e"Accessorie inaction) ) a: - Mtcrdiwerters(106,10A and 108 Series) (M)D)fuxt{onalttybyautom.Ucallydetactirg Supportsbottsm,back and side simplify the Ratellatidn process. grid failures and seamleasly lmraItionkg conduct pretties XA-SQLARSHIELD-ES RepiacemmrtsdarshWdf:rlQCombinar5/5C 0) the home ones system from d to $ _ r m I 9Y sys 9d power upp.for24a four 2-polo branch XA-ENV2-PCBA-5 IQ Gateway replacement pnntedc=ft board(PCB)for lO Combiner 5/5C —� J r backup power circuits for 240 VAC plug-in beakers (not included} Hold-down kd compatible with Eaton BRB Seriescrcut breekers(with screws)Not d r I.J X-tO-NA-HD-725A required for X-tO-AMi 240-5-HDK/X IQ-AMt-240-5C-HOK, Of Z R,p a 80 Ate[a{PV branch dreuits •Factory installed hold-down kit XA-COMMS2-PCBA-5 Replacement COM1,IS-Kf(-2p,vAWckc At board(PCB)for 10Cambinar 5/SCIn a a •Bluetooth-based+N-Fl provisioning M Q foreasy Wi-Fisstup Rating 80A 0 Re6abie Systers-liag—ralfrequency 1201240 VAC or 120/2011 VAC.60 Hz O IQ Battery 5p IQ Load Controller Durable NRTL-certified NEMA type 311 Busbarrafing Cn Full Integrated AC battery Includes H 125A y inegm rysATLih grid topsturps,energy arrclosure six field-replaceable lOBD-BAT Microinvertem. grid..,age to optimize energy consumption Faultcunant racing }O kAiC and prolong battery life 5-year limited warranty, •2-year labor reimbuxsemem program Maximumcontinuous current rating(input from PVl 64A overage included for 10 Combiner storage) KOM SKUs Branch circuits(sdar and/or storage) Uptofour2-pole Eaton BR,SiemensO or GE/ABBTHOLSerksdistributedgenaation -- •UU741 Listed (DG)breakars only(notinaluded) cr,-E a! Maximumtdaibmnchcimuitbreakermting(irupuU 80Aofdistdb,wdgnuRmb-19SAwith10GatewaybreakerIncluded EQUIPMENT �� 10GAtewayhraaker MAari5Ara6ng GE/Siemens/Eaton Included 5-yearwmitaawarnudy SPECIFICATION Production metering CT 200 Asalid core pre-installed and wuedto IQ Gateway 'Forcountiyypecificwarmmytniwmattan.see Ne R' 3v-- -ht-�8e 'Apd-un*pbvlrtw,iagaaewemotlen rormmrs otwwso�.erzeis Awnamin uw urt<easnum Gnaaa,ua�xo.irwda Rkmaa U:eusvgin�4nwnxa u«eia rev ,-_ _SIZE FnplweEmgy A9 agnurewRred Eeiphss4 C bit htdarxnireintlwtiYabtimuea. a�mrti�rE�hm,Em�.a��a„ua �. .pa�xoari-0pon,a�Eaaaspt.-p�� ANSI B 11"X 17" SH-ET HU,MFER PV-9 ACCESSORIES AND REPLACEMENT PARTS INOT INCLUDED,ORDER SEPARATELY' Consumption monitoring CT(CT-200-CLAMP) A pair of 200 A clamp-style current transformers is included with the bax IQ Battery metering CT 20D A clamp-style current transformer for IQ Battery metering,included with the box MECHANICAL DATA Dimensions(W-H-D) 37Scm•495 n,(106-)wit4.75"-ingb 6.83"). acsaaac avc«Os� Haight is 53.5 cm(21.06")with mounting brackets. _ Weight 7.5 kg(16.51b) Ambient temperature range -40•C W WC(-40'F to IWF) raacrwruucs«secfwaars Goofing Natural convectron,plus heel shield ?ISs3vs Enclosure enmonmentai rating Outdoor,NRTL-certified,NEMA type 3R.PWycarbonateconstruceon - . - 20 A to 50 A breaker inputs 14 W 4 AWG copper conductars 60 A breaker branch input:4 to 1/0 AWG..per conductors Wire sizes Main lug combined output 10 to 2/0 AWG copper conductors Neutral and graund:14 W1/0 Copper conductom Always foilow localcode requirements forcorducior sizing Built-in CTRL board 10,wired communlcatioc with the 10 Battery 5P and the Communication 6n-premise connectivity) IQ System COnR jRr 3/30.Integrated power line communicatbn for lO Series Microinverters. - =^� Akitude Up to 2.600 meters(8,530 feet) COMMUNICATION INTERFACES Integrated Wi-R 802.11b/g/n(dual band 2.4 GHz/5 GHz)for connecting the Enphase Cloud through the internal. WI-Fi range(""ORMerded) 10m(32.8 feet) Biuetooth BLE4.2,10 in range to configure W.-F.SSID Ethernet Optional,802.3.Cm5E(or DUO 6)UTP Ethernet cable(not Included)for connecting to the Enphase Cloud through the Internet. GelluiarlMobile Connect CELLMODEM-MI-06-SP-05 or CELLMODEM-Mt-06-AT-05 Onetck d with the 10 Combiner 5C) Digital 1/0 Digital input/output Us grid operator control Mobile Connect.COM0,15-KIT-01 for IQ Battery 3/3T/10/10T,COMMS-KIT-02 for USB 2.0 10 Battery 5P Access point(AP)mode For connection between the Kl Gateway andamobile device running the < Enphase installer App Y a) Metering ports Upto two ConsumptionCTs,one lO Battery CTT,and one Production CT N ' Power line Oommunication 90-110 kHz � � W Web AN See'tto-tde '-e4:^.e`3�:,3s'-- m J t— LocaIAPI S-9 d t ocai AMOf Z N O Z O p z a UL T741,CAN/CSA C22.2 No.107.1,TWO 47 CFR,Part 15,Cuss B.ICES 003, Q N J Q NOM-208-SCFI-2016,UL 61010-1,CAN/CSA 222 NO.M010A,IEEE 1547:2018(UL 1741-SEU cc 0 O 10 CombNer with IQ Gateway 3rdEd.),IEEE 2030.5/CSIIOCaopliau,Production metering:ANSI C1220 accuracy class G 02 _ O.5(PVproduction) NO�y F- IL 0 Cn PV Mlcroirnerters I06.K17,and IQB Series Micminverters IQ System Controller EP200Gi01-M240US00 COMMS-KIT-012 10 System Controller 2 EP200G101-M24OUS01 IQ Battery ENCHA4GE-3-1P-NA,ENCHARGE-10-iP-NA,ENCHARGE-3T-tP-NA, ENCHARGE-MT-iP-NA IQSystem Conholler3 SC200DUIC240US01,SC20001ll024OUSOI COMMS-KIT-OV 10 Barney IGBATTERY-5P-iP-NA EQUIPMENT SPECIFICATION ANSI B - ns«ten,ap-E« .-ea 3e 11"X 17" PV-10 IRONRIDGE Flush Mount System - - XRtO Rao XR100 Rail XRfOIXI Rail Bonded Splices it se�ca�+ A low-profile mounting rail The ultimate residential A heavyweight mounting All rails use internal splices for regions with light snow. solar mounting rail. rail for commercial projects. for seamless connections. •6,spanning capability 8'spanning capability 12'spanning capability Self-drilling screws • Moderate load capability Heavy load capability Extreme bad capability Varying versions for rails •Clear and black finish Clear and black finish •Clear anodized finish -Forms secure bonding RE UFOs Stopper Sleeves Grounding Lugs Mkroinverter Kits -.. - -- Universal Fastening Objects Snap onto the UFO to turn Conned arrays to Mount Mis or POs to XR _ --- bond modules to rails. into a bonded end clamp_ equipment ground. Rails_ �` �'- - -Fully assembled&tubed Bonds modules to rails Low profile Bonds devices to rails -Single,universal size Sized to match modules •Single tool installation •Kit comes assembled •Clear and black finish Clear and black finish Mounts in any direction Listed to UL 2703 F IronRldge builds the strongest mounting system for pitched roofs in solar.Every component has been tested to Y the limit and proven In extreme environments. FtashFoot2 Slotted L-Feet Bonding Hardware Flush Standoffs a; Our rigorous approach has led to unique structural features,such as curved rails and reinforced fiashings,and — zgg W is also why our products are fully certified,code compliant and backed by a 20-year warranty. �— — Z O n Z � O O Strength Tested PE Certified - — n <a w All components evaluated for superior Pre-stamped engineering letters Flash and mount XR Rails Drop-in design for rapid rail Bond and attach XR Rails Raise Flush Mount System m M structural performance. avaflabie€n most states- with superior waterproofing. attachment. to roof attachments. to various heights. O -Twist-on Cap eases install Secure rail connections T&Square Bolt options Works with vent flashing O •Wmd-driven rain tested Slot for vertical adjusting Nut uses 7l16"socket 4"and 7"lengths (Zi Class A Fire Rating Design Assistant Mill and black finish Clear and black finish Assembled and lubricated Ships assembled �\ Certified to maintain the fire resistance =t=- Online software makes it simple to rating of the existing root , create,share,and price projects. -- -` `- — — — �- _.- - - Design Assistant PIABCEP Certified Training E_H_ NAME UL 2703 Listed System 20-Year Warranty Go from rough layout to fully €` "s Earn free continuing education credits, engineered system For free. while learning more about our systems. EQUIPMENT �= Entire system and components meet WJM Twice the protection offered by SPECIFICATION newest effectiveUL2703standard � competitors. R �gig L ANSI B 11"X 17" nH»-NUMBER PV-11 Installation Features 5,2-21k.,I R 0 N R I D G E FlashFoote Alignment Markers lronRidgeO FlashFoot20 raises the bar in solar roof protection.The unique water sea]design is both Quickly align the flashing with chalk lines to find pilot holes. elevated and encapsulated,delivering redundant layers of protection against water intrusion.In addition,the twist-on Cap perfectly aligns the rail attachment with the lag bolt to maximize mechanical strength- ...... Rounded Corners -XI Makes it easier to handle and insert under the roof shingles- 5IGNATURE SEA- c), Reinforcement Ribs A Twist-On Cap Help to stiffen the flashing and prevent any bending or FuisirFoutzIns unctier can design encopuradis crinkling during installation. s td,is.belt.14 too.Ow P1—;mh a-ime Three-Tier star Seal I"ost,Tho Cap'dips a..I architecture 01— throe layers of protection.An elevated simcusal lh,.Vh,by akg— P the rail and tag boa in a co-shbic Platform dWarts Water away,While a stack of f bad th, S, rugged components raises the sea]an anbre pa �\�,,,,�,,, Inch.The seat is then wily—capusiated -------- -C by the Gap.FI..hF0dt20'is the fast catar -�7 attachment to pass the TAS-100 villd-Emlen Rai,Test. Benefits of Concentric Loading 1101 Traditional solar attachments have a horizontal offset between the rail and lag soo ir— v� "—P— boft,which introduces leverage on the lag L 600 bolt and decreases uplift capacity. :D 400 U) FlashFoot2@ is the only product to align D' 200 Z 0 the rail and lag boft-This concentric c W loading design results in a stronger 2 1 0 attachment for the system. Rail-to-Lag offset tin) > — Z oi Z 0 Z 0 d U 0 co Testing&Certification 0 Structural Certification U) Designed and Certified for Compliance with the International Building Code&ASCE/SEI-7- Single Socket Sim -S/ Water Seal Ratings A custom-devgn tag boft aucWc you to instan Flaswoom@=s Water Sealing Tested to UL 441 Section 27'Rain Test"and TAS 100-95'Wind Driven Rain Test'by Intertek- the same 7116-socket size g used on other Fluen Mourne g4 Ratings applicable for composition shingle roofs having slopes between 2:12 and 12:12. EMEE-NA-AE EQUIPMENT System components. water-Shedding Design UL 2703 An elevated pi umd1knmewates SPECIFICATION ...y hom Ims Water east. Conforms to UL 2703 Mechanical and Bonding Requirements-See Flush Mount Install Manual for full ratings. SHEET I ZE ANSX I B 11" 17" S'-EET NF-?VIRER PV-12 CERTIFICATE OF COMPLIANCE CERTIFICATE OF COMPLIANCE Certificate Number 20220917-E341165 Certificate Number 20220917-E341165 Report Reference E341165-20210317 Report Reference E341165-20210317s" Date 2022-09-17 Date 2022-09-17 This is to certify that representative samples of the product as specked on this Issued to: Enphase Energy Inc. certificate were tested according to the current UL requirements. 1420 N.McDowell Blvd.Petaluma,CA 94954-6515 Standards for Safety: This is to certify that Photovoltaic Grid Support Utility Interactive Inverter with Rapid UL 1741,Inverters,Converters,Controllers and Interconnection System Equipment for Use representative samples of Shutdown Functionality With Distributed Energy Resources,Edition 3,Issue Date 09/28/2021. Including the Models:IQ8-60,IQ8PLUS-72,IQ8M-72,IQ8A-72,IQ8H-208-72, requirements in UL 1741 Supplements SA and SB. IQ8H-240-72,may be f/b-2,-5,-E or-M,may be f/b-ACM,fib- US,may be fib-NM,may be f/b-RMA,may be fib-&,where W IEEE Associated interconnection and ster s(EP i itys)of Distributed Energy Resources(DERs)with _ designates additional characters. Associated Electric Power Systems(EPSs)Interfaces,Issue Date 02/15/2018 Have been investigated by UL in accordance with the Standard(s) IEEE 1547.1,IEEE Standard Conformance Test Procedures for Interconnecting Distributed indicated on this Certificate. Energy Resources(DERs)with Electric Power Systems(EPSs)Associated Interfaces,Issue Date 03/0512020. Standard(s)for Safety: See Page 2 UL 62109-1,Safety of Converters for Use in Photovoltaic Power Systems-Part 1:General Additional Information: See the UL Online Certifications Directory at Requirements;IEC 62109-2,Safety of Power Converters for use in Photovoltaic Power vrrAv Vicomfdstabase for additional information Systems-Part 2:Particular Requirements for Inverters. NER This Certificate of Compliance does not provide authorization to apply the UL Mark.Only the UL CAN/CSA C22.2 No.62109-1,Safety of Power Converters for use in photovoltaic power Follow-Up Services Procedure provides authorization to apply the UL Mark. systems-Part 1:General Requirements,2016l07 Only those products bearing the UL Mark should be considered as being UL Certified and CANICSA C22.2 No.62109-2,Safety of Power Converters for use in photovoltaic power covered under UL's Follow-Up Services. systems-Part 2:Particular requirements for inverters,2016107 Q Look for the UL Certification Mark on the product. R21:The evaluation to the Standards above provides evidence of compliance to the intent Y Z) of the existing California Rule 21 Interconnection(references to the past publication of IEEE 1547 standards)and UL1741 Table SA1.1 option to use the IEEE 1547,1-2020 and Z K Any information and documentation involving UL Mark services are provided on behalf of UL UL1741 SB test methods in conjunction with using IEEE 1547-2018 as the SRD under w LLion or any authorized licensee of UL which SA11.2 Normal Ramp Rate is not addressed.Additional testing was conducted to J J 7 confirmed compliance to Normal Ramp Rate SA11.2.See also Appendix A. p } `4 iu of Z Z a 14H(SA):The evaluation to the Standards above provides evidence of compliance to Z O p z a w HECO Rule 14H,SRD V1.0,Interconnection Application. Q LO O x�14H(SB):The evaluation to the Standards above provides evidence of compliance to O j HECO Rule 14H,SRD V2.0,Interconnection Application. O 0 EQUIPMENT SPECIFICATION ANSI B 11"X 17" PV-13 CERTIFICATE OF COMPLIANCE CERTIFICATE OF COMPLIANCE Certificate Number 20220917-E341165 Certificate Number 20220917-E341165 �� �� Report Reference E341165-20210317 Report Reference E341165-20210317 �' Date 2022-09-17 Date 2022-09-17 Inverter Firmware Version: APPENDIX Awe -vim Model UL 1998 Date Version/Revision (grid su port) ! IQ8-60,IQSPLUS-72,(Q8M-72, Yes 1 2022-08-02 2.45.04 1 As permitted by UL1741,3� Edition,Table SA1.1,shown below,allows for the evaluation of products using IQ8A-72,IQ81i-208-72,IQ8H-240-72 Yes 2022-09-09 2.48.01 k either the UL 1741 SA tests or alternative testing methods using the requirements of IEEE 1547.1-2020 in accordance with IEEE 1547-2018 and IEEE 1547A-2020. UL1741 SA test name SA test Comparable IEEE 1547.1- I Subject Inverter ]I section 2020 test section (complies with UL1741SA Anti-Islanding Pr�R.d .Z 5.10.2 J Low and High Volt 5.4.4,5.4.7 J Through Low and High Frequency Ride- SA10 I 5.5.3,5.5.4 ✓ Through € j Normal Ramp Rates SA11.2 i NA- Soft-Start Ramp Rates SA11.4 5.6 ✓ Specified Power Factor ! SA12 1 5.14.3 i ✓ VoltNar Mode SA13 5.14.4 J° Frequency-Watt SA14i 5.15.2 ✓ Q Volt-Watt SA15 5.14.9 ✓ Y u) Disable Permit Service ! SA17 5.6 J (f} Limit Active Power I SA18 [ 5.13 J Z p 0 J_ w °IEEE 1547-2018 and IEEE 1547.1-2020 do not have a requirement for,or test equivalent to,the UL 1741 SA y 0 Normal Ramp Rate which is presently a local requirement per California Rule 21 and/or Hawaii 14H.This i > Z Z d inverter has been additionally tested and is compliance with the Normal Ramp Rate test of SA112. i "'O Z O p z a w U.) J b-Functional in the following priority modes: [Xj active power[Xj reactive power C _ S O m EQUIPMENT .�.. ��uo-� ,,� a.aR� w °.�°� •� a �M,a�.� �_e�.��-� SPECIFICATION ANSI B 11"X 17" PV-14